Gene Manes.04G029700.1
Sequence ID | Manes.04G029700.1 add to my list | ||
---|---|---|---|
Species | Manihot esculenta | ||
Alias | No gene alias | ||
Length | 262aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 262 amino acids
>Manes.04G029700.1_MANES MKKMELFCASPSSTAICSSLDHRYMVRRGSTRPIEYQKSKSYKRSANKQGEFSRKISADD NSRETGIAACAKKVNDLRRKNSADHQTSDLHSPRGSSSRYLLNDDKVPYIDWISESDQRS KPSHKGSNDSPALARRSSSLANCSRDWILEPYQTTKPKNSSFVGHAPALKSSSSARSHDQ VVVLWVSIHCKGCEGKVRKHISKMEGVTSFSIDLAAKKVTVIGNVTPLGVLASLSKVKNA QLWPFPVTSSTPSSIPSTGWST
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP015837 | Unannotated cluster |
3 | GP040905 | Unannotated cluster |
4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Manes.04G029700.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
FvH4_3g34750.1 | orthology | 0.736 | 3 | - | - |
Manes.11G135800.1 | ultra-paralogy | 0.308 | 0 | - | - |
cajca.ICPL87119.gnm1.ann1.C.cajan_13578.1 | orthology | 0.705 | 3 | - | - |
cajca.ICPL87119.gnm1.ann1.C.cajan_21421.1 | orthology | 0.662 | 3 | - | - |
cicar_pan_p009348 | orthology | 0.827 | 3 | - | - |
maldo_pan_p016590 | orthology | 0.77 | 3 | - | - |
maldo_pan_p031809 | orthology | 0.781 | 3 | - | - |
medtr_pan_p012804 | orthology | 0.803 | 3 | - | - |
phavu.G19833.gnm2.ann1.Phvul.011G068500.1 | orthology | 0.781 | 4 | - | - |
phavu.G19833.gnm2.ann1.Phvul.011G068700.1 | orthology | 0.769 | 4 | - | - |
soybn_pan_p006620 | orthology | 0.746 | 3 | - | - |
soybn_pan_p008062 | orthology | 0.65 | 4 | - | - |
soybn_pan_p029253 | orthology | 0.671 | 4 | - | - |
soybn_pan_p035488 | orthology | 0.747 | 3 | - | - |
soybn_pan_p037693 | orthology | 0.862 | 3 | - | - |