Gene Manes.05G138100.1
| Sequence ID | Manes.05G138100.1 add to my list |
|---|---|
| Species | Manihot esculenta |
| Alias | No gene alias |
| Length | 147aa |
Length: 147 amino acids
>Manes.05G138100.1_MANES MQFYCMVMRINIDCNGCYRKVRKALLDMHGKYTKIHRFSSKLQFFFTLFFFLPFSAINTE LETHLIEKKQSRVSVCGKFIPQDVAIKIRNKTNRRVEILDIQELVTNTAAAAAADADNQN NQENRTLISSSSWSLLPSQTQMAPCVT
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP109350 | Unannotated cluster |
| 3 | GP119142 | Unannotated cluster |
| 4 | GP077996 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Bv5_110870_wcqq.t1 | orthology | 0.879 | 6 | 97.4 | 7.2e-21 |
| Bv5_110870_wcqq.t2 | orthology | 0.879 | 6 | - | - |
| CgUng002450.1 | orthology | 0.609 | 5 | 111.7 | 3.8e-25 |
| Cm118330.1 | orthology | 0.607 | 4 | 111.3 | 8.3e-25 |
| Cs7g26570.1 | orthology | 0.609 | 5 | 111.7 | 4.1e-25 |
| FvH4_5g12320.1 | orthology | 0.759 | 4 | 113.6 | 1e-25 |
| PGSC0003DMP400010112 | orthology | 0.83 | 3 | - | - |
| Solyc03g119630.2.1 | orthology | 0.87 | 4 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_35493.1 | orthology | 0.647 | 2 | 110.5 | 1e-24 |
| capan_pan_p000343 | orthology | 0.997 | 4 | 76.6 | 3.94e-19 |
| cicar_pan_p024669 | orthology | 0.885 | 3 | 109 | 8.49e-32 |
| cucsa_pan_p010693 | orthology | 0.735 | 6 | 108 | 1.87e-31 |
| maldo_pan_p026714 | orthology | 0.744 | 4 | 112 | 9.12e-33 |
| medtr_pan_p036900 | orthology | 0.883 | 3 | 112 | 9.5e-33 |
| phavu.G19833.gnm2.ann1.Phvul.004G158700.1 | orthology | 0.714 | 2 | 108.6 | 3.4e-24 |
| soybn_pan_p040036 | orthology | 0.943 | 2 | - | - |
| soybn_pan_p040183 | orthology | 0.587 | 2 | 118 | 3.46e-35 |
| soybn_pan_p040952 | orthology | 0.564 | 2 | - | - |
| soybn_pan_p042566 | orthology | 0.646 | 2 | - | - |
| thecc_pan_p001600 | orthology | 0.612 | 5 | 121 | 9.16e-36 |
| vitvi_pan_p014384 | orthology | 0.496 | 4 | 137 | 1.67e-41 |