Gene Manes.06G027700.1
Sequence ID | Manes.06G027700.1 add to my list | ||
---|---|---|---|
Species | Manihot esculenta | ||
Alias | No gene alias | ||
Length | 219aa | ||
Gene Ontology |
![]()
|
Length: 219 amino acids
>Manes.06G027700.1_MANES MASKKEEKKVDEVITAVYKVNLHCLKCAQDIKKPLMTIQGVHNVEYDVEKAEIKVKGAID VLKIHKQIEKLSRKKVELVSPQIKIKETADVEKKVVKETKQSTCDAGIYNVKTDKKAQTL TVHGTIEAEKLLAYIRRKVHKNAEILTEKKEEKITELKEEKAKVEEKAKVEAKSDKIIEF KEEKKVEVKTKEGDAPYFIHYVYAPQLFSDENPNACIIL
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP342504 | Unannotated cluster |
4 | GP464372 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Manes.06G027700.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
FvH4_7g08060.1 | orthology | 0.801 | 4 | 106.3 | 2.5e-23 |
MELO3C006231.2.1 | orthology | 0.692 | 3 | 110.2 | 1.5e-24 |
cajca.ICPL87119.gnm1.ann1.C.cajan_43449.1 | orthology | 0.755 | 5 | 164.5 | 8.7e-41 |
cicar_pan_p023345 | orthology | 0.719 | 4 | 176 | 4.17e-55 |
cucsa_pan_p017527 | orthology | 0.69 | 3 | 156 | 1.55e-47 |
maldo_pan_p031662 | orthology | 0.532 | 3 | 183 | 5.89e-57 |
maldo_pan_p050157 | orthology | 0.797 | 4 | - | - |
medtr_pan_p005600 | orthology | 0.74 | 4 | 171 | 7.5e-53 |
phavu.G19833.gnm2.ann1.Phvul.010G034132.1 | orthology | 0.76 | 5 | 164.5 | 7.8e-41 |
soybn_pan_p031851 | orthology | 0.726 | 4 | 167 | 2.04e-51 |
soybn_pan_p035421 | orthology | 0.792 | 4 | - | - |