Gene Manes.08G050200.1
Sequence ID | Manes.08G050200.1 add to my list |
---|---|
Species | Manihot esculenta |
Alias | No gene alias |
Length | 79aa |
Length: 79 amino acids
>Manes.08G050200.1_MANES MAAKYIIPGVIGSFAIAYLSDLLIADKKIFGGTTPKTVASNEWWEETDKKFQAWPRTAGP PVVMNPISRQNFIVKSRES
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Unknown function duf1138 family
GP002478 |
Unknown function duf1138 family |
2 | GP018276 | Unannotated cluster |
3 | GP042981 | Unannotated cluster |
4 | GP072479 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Protein of unknown function DUF1138
IPR009515
|
Protein of unknown function DUF1138 | Family |
Figure 1: IPR domains for Manes.08G050200.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Cg9g021560.1 | orthology | 0.54 | 2 | - | - |
Cs9g12580.1 | orthology | 0.486 | 2 | - | - |