Gene Manes.08G099200.1


Sequence ID Manes.08G099200.1  add to my list
Species Manihot esculenta
Alias No gene alias
Length 148aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 148 amino acids

>Manes.08G099200.1_MANES
MFGWLSGSSKPSNAMSIVELSVHMDCEGCEKRIRRAISKIHGVDSLEIDMDKQRVTVTGY
VDQRKVLKIVRRTGRRAEFWPFPYDSEYYPYASQYLDESTYTTSYNYYRHGFNESVHGYF
PDQAYCTVDDNAVHLFSEDNVHAYCSIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP078604 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Manes.08G099200.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
AT3G56891.1 orthology 0.706 4 139.4 1.8e-33
Ca_28_123.1 orthology 0.525 5 - -
Ca_31_155.3 orthology 0.481 5 - -
Ca_64_676.1 orthology 0.441 5 - -
Ca_78_1273.1 orthology 0.481 5 - -
Cc06_g21060 orthology 0.396 5 131 5.8e-31
Cg6g011520.1 orthology 0.256 5 199.1 1.8e-51
Cs6g10930.1 orthology 0.25 5 193 1.4e-49
DCAR_016949 orthology 0.541 5 142 7.65e-45
FvH4_2g26780.1 orthology 0.257 3 191.4 3.9e-49
MELO3C019416.2.1 orthology 0.335 5 181 4.6e-46
Oeu053981.1 orthology 0.462 6 103.6 1.7e-22
brana_pan_p032952 orthology 0.854 5 - -
brana_pan_p033418 orthology 0.824 6 - -
brana_pan_p049288 orthology 0.853 4 151 1.41e-47
braol_pan_p001934 orthology 0.859 5 152 9e-48
braol_pan_p038031 orthology 0.801 5 - -
brarr_pan_p006813 orthology 0.825 6 148 2.56e-46
brarr_pan_p018750 orthology 0.858 4 - -
cajca.ICPL87119.gnm1.ann1.C.cajan_46944.1 orthology 0.392 7 161.4 5e-40
cucsa_pan_p011351 orthology 0.368 5 217 4.19e-74
ipotf_pan_p003030 orthology 0.621 7 180 3.25e-59
itb11g01700.t1 orthology 0.617 7 141.7 4.2e-34
maldo_pan_p024328 orthology 0.341 3 - -
maldo_pan_p038662 orthology 0.247 3 196 2.05e-65
medtr_pan_p030129 orthology 0.343 5 169 1.42e-55
phavu.G19833.gnm2.ann1.Phvul.004G052700.1 orthology 0.391 6 176 1.8e-44
soybn_pan_p020075 orthology 0.409 7 173 5.92e-57
thecc_pan_p019791 orthology 0.209 4 201 8.6e-68
vitvi_pan_p003255 orthology 0.253 3 176 1.59e-57