Gene Manes.09G066300.1


Sequence ID Manes.09G066300.1  add to my list
Species Manihot esculenta
Alias No gene alias
Length 231aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 231 amino acids

>Manes.09G066300.1_MANES
MGAEKKPAAAEPAGGGEKKDDAKVISVYKVDMHCEGCAKKIRRASTVVLKIRTHCDGCIS
KMKKIILKFKGVNSVTVDGPKDLVTVKGTMDAKEMVPYLKEKLRRNVDVVPPKKEEEKKG
GDGEKKEGDGGKKEAAAAASGGGGAKVEVSKMEYYPAPAPTHWFDGMFGHSYAAEPQHGS
YPVNHGYPMMTHGYVQQGYVNQGYVMEPAYHHPMHAPQMFSDENPNSCSVM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015545		 Heavy metal transport/detoxification group1
3 GP342504 Unannotated cluster
4 GP464372 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Manes.09G066300.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
CgUng002500.1 orthology 0.405 4 - -
CgUng019980.1 orthology 0.405 4 - -
Cm060230.1 orthology 0.407 2 - -
FvH4_6g16410.1 orthology 0.694 4 - -
MELO3C024466.2.1 orthology 0.663 4 - -
Manes.08G010600.1 ultra-paralogy 0.163 0 - -
cucsa_pan_p001888 orthology 0.674 4 - -
maldo_pan_p018618 orthology 0.66 4 - -
maldo_pan_p021518 orthology 0.673 4 - -
orange1.1t00956.1 orthology 0.408 3 - -