Gene Manes.15G018700.1
| Sequence ID | Manes.15G018700.1 add to my list | ||
|---|---|---|---|
| Species | Manihot esculenta | ||
| Alias | No gene alias | ||
| Length | 131aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 131 amino acids
>Manes.15G018700.1_MANES MADEKENDQLKVITVEFKVSMYCNACERNVAKTISKFKGVETFTTDMNKHKVVVIGCIDP QKLVKKLKKKTGKRVEIIVKKEEEEEEKEKATKENYDNQGNDAGPPFFLDFCEEELLMSF SDENPNACSVM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP345758 | Unannotated cluster |
| 4 | GP467256 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Manes.15G018700.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT3G21490.1 | orthology | 0.896 | 3 | 103.2 | 1.3e-22 |
| Ca_27_985.2 | orthology | 1 | 8 | - | - |
| Ca_34_139.2 | orthology | 1 | 8 | - | - |
| Ca_43_446.2 | orthology | 1 | 7 | - | - |
| Cc03_g02440 | orthology | 1 | 7 | 80.9 | 6.1e-16 |
| Cg9g003840.1 | orthology | 0.852 | 6 | 105.9 | 1.9e-23 |
| Cm135610.1 | orthology | 0.884 | 6 | 107.5 | 1.1e-23 |
| Cs9g05250.1 | orthology | 0.767 | 5 | 115.2 | 3.3e-26 |
| DCAR_030575 | orthology | 1 | 6 | 91.3 | 5.6e-19 |
| FvH4_3g29750.1 | orthology | 0.841 | 5 | 121.3 | 4.4e-28 |
| FvH4_4g16960.1 | orthology | 0.836 | 5 | - | - |
| HanXRQChr08g0226491 | orthology | 1 | 6 | 99.8 | 2.2e-21 |
| MELO3C021374.2.1 | orthology | 0.962 | 6 | 121.7 | 2.9e-28 |
| Solyc03g098650.2.1 | orthology | 1 | 6 | 91.3 | 5.3e-19 |
| brana_pan_p026722 | orthology | 0.929 | 5 | 123 | 4.57e-37 |
| braol_pan_p034893 | orthology | 0.943 | 4 | 123 | 5.88e-37 |
| braol_pan_p054032 | orthology | 1 | 3 | - | - |
| brarr_pan_p010495 | orthology | 0.936 | 5 | 124 | 2.6e-37 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_04222.1 | orthology | 0.955 | 7 | 109.8 | 1.5e-24 |
| cicar_pan_p022803 | orthology | 0.921 | 7 | 114 | 5.45e-34 |
| cucsa_pan_p017292 | orthology | 0.997 | 6 | 134 | 6.5e-42 |
| medtr_pan_p033077 | orthology | 0.959 | 7 | 129 | 8.22e-40 |
| phavu.G19833.gnm2.ann1.Phvul.003G099700.1 | orthology | 1 | 8 | 108.2 | 4e-24 |
| soybn_pan_p008694 | orthology | 0.963 | 8 | 127 | 1.1e-38 |
| soybn_pan_p032351 | orthology | 0.997 | 8 | - | - |
| thecc_pan_p001371 | orthology | 0.585 | 2 | 149 | 1.1e-47 |
| vitvi_pan_p022438 | orthology | 0.952 | 4 | 123 | 2.87e-37 |
| vitvi_pan_p032656 | orthology | 0.943 | 4 | - | - |