Gene Manes.15G023400.1
Sequence ID | Manes.15G023400.1 add to my list | ||
---|---|---|---|
Species | Manihot esculenta | ||
Alias | No gene alias | ||
Length | 508aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 508 amino acids
>Manes.15G023400.1_MANES MSKEEFLKIQTCVLKVNIHCDGCKQKVKKILQKIDGVFTTKIDSEQGKVTVSGNVDPAVL IKKLGKSGKHAELWGAQKANNNQNHLPNQLKNMQIDNGKGGNNKDQKGNNGQKGNNNNNN QPKGGQQNQNPQLQLNQQQMQQLLQQQQNMKALQDLSRLPQFKDLKLPPNNNQNQKAAKF APPEDEDFSDDDYDEFDDDDFDEDDEFDDEMDDPRHPINKMKTVMPNGNMMMNGWPPQLL NAQKGAANDGGNGKKGGGGIGGNGNGAVPMQVNIGGGNGNGAKKGGGGGGGGNNNGGTQN QGGKNGGKPQDGKNGNNGGGGNNKNGNNGNAGAGGNGNNMQMNGGKKGNNGGGGGGGGKI DGLPSMGGPHGNMGQMGNLNLPMSQMGSVSMGQMGNIPAVQGLPAAAAMSGGGGGPNGYF QGAGPDLMPGNPYHQQQQQQQQYVQALMNQQRAMGNERFQPMMYARPPPAVNYMPPYPYP YPYPPPHPGSDPYVNFFSDENTSSCSVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP023608 | Unannotated cluster |
3 | GP040483 | Unannotated cluster |
4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Manes.15G023400.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Cg9g004610.1 | orthology | 0.418 | 5 | 322 | 2.1e-104 |
Cm080580.1 | orthology | 0.428 | 5 | 335 | 1.61e-109 |
Cs9g06110.1 | orthology | 0.423 | 4 | 326 | 4.92e-106 |
FvH4_4g14520.1 | orthology | 0.434 | 4 | 271 | 5.93e-85 |
MELO3C006564.2.1 | orthology | 0.562 | 5 | - | - |
Manes.03G184400.1 | ultra-paralogy | 0.119 | 0 | - | - |
cajca.ICPL87119.gnm1.ann1.C.cajan_04403.1 | orthology | 0.604 | 6 | - | - |
cajca.ICPL87119.gnm1.ann1.C.cajan_04404.1 | orthology | 0.736 | 6 | 194 | 1.57e-56 |
cajca.ICPL87119.gnm1.ann1.C.cajan_05307.1 | orthology | 0.475 | 5 | - | - |
cicar_pan_p021612 | orthology | 0.54 | 5 | - | - |
cicar_pan_p023752 | orthology | 0.479 | 5 | 213 | 7.39e-63 |
cucsa_pan_p014828 | orthology | 0.576 | 5 | - | - |
maldo_pan_p033071 | orthology | 0.404 | 4 | 308 | 1.06e-98 |
medtr_pan_p010037 | orthology | 0.495 | 5 | 254 | 1.74e-78 |
medtr_pan_p012132 | orthology | 0.536 | 5 | - | - |
medtr_pan_p023169 | orthology | 0.91 | 4 | - | - |
phavu.G19833.gnm2.ann1.Phvul.003G092500.1 | orthology | 0.551 | 5 | - | - |
phavu.G19833.gnm2.ann1.Phvul.006G153400.1 | orthology | 0.526 | 6 | 289 | 5.32e-92 |
soybn_pan_p017385 | orthology | 0.482 | 6 | 274 | 5.41e-86 |
soybn_pan_p023921 | orthology | 0.461 | 6 | - | - |
soybn_pan_p028758 | orthology | 0.512 | 6 | - | - |
soybn_pan_p032758 | orthology | 0.534 | 6 | - | - |
thecc_pan_p006423 | orthology | 0.328 | 1 | 324 | 2.31e-105 |