Gene Mba01_g01930.1
Sequence ID | Mba01_g01930.1 add to my list | ||
---|---|---|---|
Species | Musa balbisiana | ||
Alias | No gene alias | ||
Length | 203aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 203 amino acids
>Mba01_g01930.1_MUSBA MKTGVEDVKTDCKSRTVVIKGKAADPANICERIQKKTGKKVELISPLPKPPEEEEKKEEA EAPPEETKEEPKPITVILKVRMHCERCAQVLQKRIKKMDGVESVATDLASSQVIVTGFID PVKLAENVHRRTRKQASIVPEEEKKEEEGEKKDDNGDEEKKQEEEDVKDDISKYEYWPSR DYVEYAYTPQTFSDENPNACSVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP342504 | Unannotated cluster |
4 | GP464372 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Mba01_g01930.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Dr07989 | orthology | 0.525 | 3 | 165.6 | 2.9e-41 |
ORGLA10G0044600.1 | orthology | 0.615 | 4 | 136 | 2.9e-32 |
XP_008785647.1 | orthology | 0.318 | 4 | 192.6 | 4e-49 |
XP_008790335.1 | orthology | 0.327 | 4 | - | - |
XP_010939247.1 | orthology | 0.324 | 5 | 197.2 | 1.7e-50 |
cocnu_pan_p027064 | orthology | 0.297 | 5 | 180 | 2.01e-58 |
cocnu_pan_p028794 | orthology | 0.349 | 4 | - | - |
musac_pan_p010117 | orthology | 0.0392 | 1 | 288 | 1.88e-99 |
orysa_pan_p012537 | orthology | 0.615 | 4 | 155 | 8.07e-47 |