Gene Mba01_g28000.1


Sequence ID Mba01_g28000.1  add to my list
Species Musa balbisiana
Alias No gene alias
Length 78aa



Length: 78 amino acids

>Mba01_g28000.1_MUSBA
MATGKIIGAVVASFAVAYACDVLIADKKIFGGTTPKTVSDEWWEETDKKFQAWPRTAGPP
VVMNPISRQNFIVKSSES





Clustering Level Family ID Family Name
1
Unknown function duf1138 family
GP002478
Unknown function duf1138 family
2 GP018276 Unannotated cluster
3 GP042981 Unannotated cluster
4 GP072479 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Protein of unknown function DUF1138
IPR009515
Protein of unknown function DUF1138 Family

IPR009515
Figure 1: IPR domains for Mba01_g28000.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
XP_008779151.1 orthology 0.483 2 - -
XP_019709224.1 orthology 0.575 3 - -
XP_026665743.1 orthology 0.44 2 - -
XP_026665744.1 orthology 0.44 3 - -
XP_026665745.1 orthology 0.44 3 - -
XP_026665746.1 orthology 0.44 3 - -
cocnu_pan_p023003 orthology 0.869 3 - -
cocnu_pan_p029006 orthology 0.869 3 - -
musac_pan_p013029 orthology 0.0264 1 155 1e-51