Gene Mba01_g28000.1
Sequence ID | Mba01_g28000.1 add to my list |
---|---|
Species | Musa balbisiana |
Alias | No gene alias |
Length | 78aa |
Length: 78 amino acids
>Mba01_g28000.1_MUSBA MATGKIIGAVVASFAVAYACDVLIADKKIFGGTTPKTVSDEWWEETDKKFQAWPRTAGPP VVMNPISRQNFIVKSSES
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Unknown function duf1138 family
GP002478 |
Unknown function duf1138 family |
2 | GP018276 | Unannotated cluster |
3 | GP042981 | Unannotated cluster |
4 | GP072479 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Protein of unknown function DUF1138
IPR009515
|
Protein of unknown function DUF1138 | Family |
Figure 1: IPR domains for Mba01_g28000.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
XP_008779151.1 | orthology | 0.483 | 2 | - | - |
XP_019709224.1 | orthology | 0.575 | 3 | - | - |
XP_026665743.1 | orthology | 0.44 | 2 | - | - |
XP_026665744.1 | orthology | 0.44 | 3 | - | - |
XP_026665745.1 | orthology | 0.44 | 3 | - | - |
XP_026665746.1 | orthology | 0.44 | 3 | - | - |
cocnu_pan_p023003 | orthology | 0.869 | 3 | - | - |
cocnu_pan_p029006 | orthology | 0.869 | 3 | - | - |
musac_pan_p013029 | orthology | 0.0264 | 1 | 155 | 1e-51 |