Gene Mba02_g11510.1


Sequence ID Mba02_g11510.1  add to my list
Species Musa balbisiana
Alias No gene alias
Length 117aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 117 amino acids

>Mba02_g11510.1_MUSBA
MLLSGSLTDAGVDTVEIDMDKQKVTVTGYVEERKVIKAVRRTGRKAELWPFPYDAEYYPF
ALQYLEDSTFSSTHNYYRHGYTSTVHGYFPDAAYSMIVDDHAFALFNDDNVHACVIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP078604 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Mba02_g11510.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Dr00501 orthology 0.371 3 190.3 6.4e-49
HORVU6Hr1G066220.1 orthology 0.832 4 162.2 2.4e-40
Sspon.04G0006170-1A orthology 0.981 4 - -
Sspon.04G0023540-1B orthology 1 4 152.5 5.1e-37
XP_008783549.1 orthology 0.322 5 188.3 4.4e-48
XP_010934033.1 orthology 0.263 5 191 7.2e-49
cocnu_pan_p034578 orthology 0.301 4 184 9.92e-62
maize_pan_p014734 orthology 0.967 4 139 6.94e-44
musac_pan_p001552 orthology 0.0684 1 221 5.47e-76
orysa_pan_p046445 orthology 0.614 3 159 2.48e-51
sorbi_pan_p005993 orthology 0.688 3 149 3.5e-47
tritu_pan_p005371 orthology 0.628 4 - -
tritu_pan_p026136 orthology 0.633 4 152 2.38e-48