Gene Mba03_g04290.1


Sequence ID Mba03_g04290.1  add to my list
Species Musa balbisiana
Alias No gene alias
Length 149aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 149 amino acids

>Mba03_g04290.1_MUSBA
MGGTLECFSSFLGSDRRHKKRKQFQTVELKVRMDCEGCELKVRNALSTMRGVQSVDINRK
QYKVTVTGYVEPHKVIKRVQSTGKKAELWPYVPYNLVAHPYVAPTYDKKAPPGYVRNMEV
ITVSSQVVRPEDQLTSLFSDDNPNACSIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463678 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Mba03_g04290.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
HORVU4Hr1G017070.3 orthology 0.822 3 - -
HORVU5Hr1G057730.1 orthology 0.341 4 - -
ORGLA08G0122800.1 orthology 0.719 3 - -
ORGLA09G0055900.1 orthology 0.374 3 - -
Sspon.02G0015890-1A orthology 0.389 3 - -
Sspon.02G0015890-1P orthology 0.389 3 - -
Sspon.02G0015890-2B orthology 0.395 3 - -
Sspon.02G0015890-3C orthology 0.388 2 - -
Sspon.06G0006630-1A orthology 0.819 3 - -
Sspon.06G0006630-2B orthology 0.831 3 - -
Sspon.06G0006630-3D orthology 0.827 3 - -
bradi_pan_p018769 orthology 0.734 2 - -
bradi_pan_p035294 orthology 0.387 3 - -
maize_pan_p015391 orthology 0.833 4 - -
maize_pan_p019318 orthology 0.464 3 - -
maize_pan_p026014 orthology 0.388 2 - -
musac_pan_p042970 orthology 0.0211 1 301 5.73e-107
orysa_pan_p001816 orthology 0.719 3 - -
orysa_pan_p036963 orthology 0.374 3 - -
sorbi_pan_p005802 orthology 0.833 4 - -
sorbi_pan_p010711 orthology 0.384 2 - -
tritu_pan_p031184 orthology 0.785 3 - -
tritu_pan_p036816 orthology 0.341 4 - -