Gene Mba04_g33020.1


Sequence ID Mba04_g33020.1  add to my list
Species Musa balbisiana
Alias No gene alias
Length 155aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 155 amino acids

>Mba04_g33020.1_MUSBA
MGFLEHISEICSFPSSHNKFKKKNQLQTVEIKVRMDCEGCERKVRKAVEGMKGVSSVEIE
PKQHKVTVVGYVDPKKVIRRVAWKTGKKAEPWPYVPYDVVAHPYAPGAYDKKAPPGYVRN
VVDDPAAAPLARASSTEVKYTTAFSDDNPNNCSVM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463617 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Mba04_g33020.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
HORVU2Hr1G011060.1 orthology 0.467 5 - -
HORVU6Hr1G009000.1 orthology 0.478 3 224.2 6.7e-59
HORVU7Hr1G090970.1 orthology 0.598 3 - -
ORGLA04G0039000.1 orthology 0.463 4 241.5 3.8e-64
Sspon.05G0013620-1A orthology 0.426 3 - -
Sspon.05G0013620-2B orthology 0.413 3 240.4 2.4e-63
Sspon.05G0013620-3C orthology 0.413 3 - -
Sspon.05G0013620-4D orthology 0.42 2 - -
bradi_pan_p006044 orthology 0.493 4 - -
bradi_pan_p040029 orthology 0.442 2 - -
maize_pan_p004232 orthology 0.394 2 241 2.86e-83
musac_pan_p005239 orthology 0 1 319 4.3e-114
orysa_pan_p007886 orthology 0.463 4 - -
sorbi_pan_p013767 orthology 0.439 3 - -
tritu_pan_p002673 orthology 0.496 5 244 4.91e-84
tritu_pan_p014563 orthology 0.454 3 - -
tritu_pan_p034454 orthology 0.606 3 - -