Gene Mba04_g33020.1
Sequence ID | Mba04_g33020.1 add to my list | ||
---|---|---|---|
Species | Musa balbisiana | ||
Alias | No gene alias | ||
Length | 155aa | ||
Gene Ontology |
![]()
|
Length: 155 amino acids
>Mba04_g33020.1_MUSBA MGFLEHISEICSFPSSHNKFKKKNQLQTVEIKVRMDCEGCERKVRKAVEGMKGVSSVEIE PKQHKVTVVGYVDPKKVIRRVAWKTGKKAEPWPYVPYDVVAHPYAPGAYDKKAPPGYVRN VVDDPAAAPLARASSTEVKYTTAFSDDNPNNCSVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Mba04_g33020.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
HORVU2Hr1G011060.1 | orthology | 0.467 | 5 | - | - |
HORVU6Hr1G009000.1 | orthology | 0.478 | 3 | 224.2 | 6.7e-59 |
HORVU7Hr1G090970.1 | orthology | 0.598 | 3 | - | - |
ORGLA04G0039000.1 | orthology | 0.463 | 4 | 241.5 | 3.8e-64 |
Sspon.05G0013620-1A | orthology | 0.426 | 3 | - | - |
Sspon.05G0013620-2B | orthology | 0.413 | 3 | 240.4 | 2.4e-63 |
Sspon.05G0013620-3C | orthology | 0.413 | 3 | - | - |
Sspon.05G0013620-4D | orthology | 0.42 | 2 | - | - |
bradi_pan_p006044 | orthology | 0.493 | 4 | - | - |
bradi_pan_p040029 | orthology | 0.442 | 2 | - | - |
maize_pan_p004232 | orthology | 0.394 | 2 | 241 | 2.86e-83 |
musac_pan_p005239 | orthology | 0 | 1 | 319 | 4.3e-114 |
orysa_pan_p007886 | orthology | 0.463 | 4 | - | - |
sorbi_pan_p013767 | orthology | 0.439 | 3 | - | - |
tritu_pan_p002673 | orthology | 0.496 | 5 | 244 | 4.91e-84 |
tritu_pan_p014563 | orthology | 0.454 | 3 | - | - |
tritu_pan_p034454 | orthology | 0.606 | 3 | - | - |