Gene Mba05_g07700.1
| Sequence ID | Mba05_g07700.1 add to my list | ||
|---|---|---|---|
| Species | Musa balbisiana | ||
| Alias | No gene alias | ||
| Length | 320aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 320 amino acids
>Mba05_g07700.1_MUSBA MNQCVITDSTMGEAKQEAEAKQEEKKEEKAEEKKEVPKTVTSFPPSSCRWTCTVLDVRRR SRNPYSNAEIPTSGVESVEMGMTQNQVTVKGIVDPRTLCSMIQKRTMRKAGVLSPLPPAE GDYKPEAVPSQGACAEQLKTKRLKMRGVQAAVTDLRAGKVTVTGTMNGEKLVEYIRRRTG KVASIVPQPPKEEQKEEAEKKPEETPAEGKKEEKQTEEKKEEVKSPQPQDSAGSNKDGDG KEEKGGGEEQKEEGGGEATAAGVSEADVIKKMIYWNGSFIGEDEMARRMLHWMPVYVIQQ PPPPPPQLCSDENPNACCVS
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP126431 | Unannotated cluster |
| 4 | GP077890 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Mba05_g07700.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| XP_008783550.1 | orthology | 0.413 | 3 | - | - |
| XP_008808288.1 | orthology | 0.449 | 2 | - | - |
| XP_008808289.1 | orthology | 0.449 | 2 | - | - |
| XP_010911103.1 | orthology | 0.596 | 3 | - | - |
| XP_010919013.1 | orthology | 0.48 | 3 | - | - |
| XP_010934034.1 | orthology | 0.434 | 4 | - | - |
| cocnu_pan_p018242 | orthology | 0.502 | 3 | - | - |
| cocnu_pan_p019921 | orthology | 0.44 | 4 | - | - |
| musac_pan_p044150 | orthology | 0.242 | 1 | - | - |