Gene Mba06_g17710.1


Sequence ID Mba06_g17710.1  add to my list
Species Musa balbisiana
Alias No gene alias
Length 100aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 100 amino acids

>Mba06_g17710.1_MUSBA
MAETVVLKVGMSCQGCVGAVKRVLTKMEGVESFDVDLKEQKVTVKGNVKPEDVFQTVSKT
GKKTSFWEAEPEAKEAALAAPTEEDAPSAPDAVADVTTAA




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP239638 Unannotated cluster
3 GP341755 Unannotated cluster
4 GP463817 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Mba06_g17710.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
HORVU7Hr1G100230.1 orthology 0.676 3 122.1 2.3e-28
Sspon.04G0025740-1B orthology 0.537 4 - -
Sspon.04G0025740-2C orthology 0.537 4 - -
Sspon.04G0025740-3D orthology 0.537 4 - -
bradi_pan_p000852 orthology 0.571 2 128 3.94e-40
maize_pan_p017319 orthology 0.506 2 122 9.34e-38
musac_pan_p007187 orthology 0.0245 1 154 3.23e-50
orysa_pan_p027340 orthology 0.447 2 127 4.34e-39
sorbi_pan_p000050 orthology 0.531 3 - -
tritu_pan_p009809 orthology 0.722 2 122 1.2e-37
tritu_pan_p034911 orthology 0.653 3 - -
tritu_pan_p050141 orthology 0.673 2 - -