Gene Mba07_g04570.1
| Sequence ID | Mba07_g04570.1 add to my list |
|---|---|
| Species | Musa balbisiana |
| Alias | No gene alias |
| Length | 131aa |
Length: 131 amino acids
>Mba07_g04570.1_MUSBA MVWRDRGFNSFPRFSGEQKEPWGGGIRGVIAYESGTYMLSRRKGDKKIKSSNMATGKIIG AIIASFAVSYACDTLISDGKIFGGTTPKTVSDKEWWEATDKKFQAWPRTAGPPVVMNPIS RQNFIVKSSES
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Unknown function duf1138 family
GP002478 |
Unknown function duf1138 family |
| 2 | GP018276 | Unannotated cluster |
| 3 | GP042981 | Unannotated cluster |
| 4 | GP072479 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Protein of unknown function DUF1138
IPR009515
|
Protein of unknown function DUF1138 | Family |
Figure 1: IPR domains for Mba07_g04570.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| XP_008779151.1 | orthology | 0.658 | 2 | 134 | 1.1e-31 |
| XP_019709224.1 | orthology | 0.75 | 3 | - | - |
| XP_026665743.1 | orthology | 0.615 | 2 | - | - |
| XP_026665744.1 | orthology | 0.615 | 3 | - | - |
| XP_026665745.1 | orthology | 0.615 | 3 | - | - |
| XP_026665746.1 | orthology | 0.615 | 3 | - | - |
| cocnu_pan_p023003 | orthology | 1 | 3 | - | - |
| cocnu_pan_p029006 | orthology | 1 | 3 | 129 | 1.74e-40 |
| musac_pan_p019196 | orthology | 0.109 | 1 | - | - |
| musac_pan_p043143 | orthology | 0.191 | 1 | 170 | 4.75e-56 |