Gene ORGLA03G0014000.1
Sequence ID | ORGLA03G0014000.1 add to my list | ||
---|---|---|---|
Species | Oryza glaberrima | ||
Alias | No gene alias | ||
Length | 193aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 193 amino acids
>ORGLA03G0014000.1_ORYGL MSTVSSALSSFLYCCFSPTGGHRHGHRAGAYYYSSHPTSTNTYYYEGGLAGRRMGRSRPL SLQTVELKVRMCCSGCERVVKHALMKLRGVDSVEVELEMEKVTVTGYVERQRVLKEVRRA GKKAEFWPNPDLPLYFTSAKDYFHDEESFRPSYNYYRHGYNGDKHGHLPEPHRGADPVSN LFNDDDVNACSIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for ORGLA03G0014000.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
orysa_pan_p008800 | orthology | 0 | 1 | 381 | 3.79e-137 |