Gene ORGLA06G0009300.1
| Sequence ID | ORGLA06G0009300.1 add to my list |
|---|---|
| Species | Oryza glaberrima |
| Alias | No gene alias |
| Length | 77aa |
Length: 77 amino acids
>ORGLA06G0009300.1_ORYGL MTAGYIAGSLIGSFAIAYLCDTFVSDKKAFGGSIPKTVSDKEWWQATDTKFQAWPRTAGP PVIMNPISRQNFIVKST
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Unknown function duf1138 family
GP002478 |
Unknown function duf1138 family |
| 2 | GP018276 | Unannotated cluster |
| 3 | GP042981 | Unannotated cluster |
| 4 | GP072479 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Protein of unknown function DUF1138
IPR009515
|
Protein of unknown function DUF1138 | Family |
Figure 1: IPR domains for ORGLA06G0009300.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| orysa_pan_p049257 | orthology | 0.0152 | 1 | 162 | 2.57e-53 |