Gene ORGLA08G0122800.1
Sequence ID | ORGLA08G0122800.1 add to my list | ||
---|---|---|---|
Species | Oryza glaberrima | ||
Alias | No gene alias | ||
Length | 150aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 150 amino acids
>ORGLA08G0122800.1_ORYGL MGGTLHYLSDLLLGGSSGKTSHKKKRQFNTVELKVRMDCDGCELKVRNTLANMKGVQSVE INRKQQKVTVQGMVDTQRVLRRAQSTGKRTELWPYVPYTNPYVAPPAAYDKKAPNGHIRR VDAVLPVTPSQEERLATLFSDDNPNACAVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for ORGLA08G0122800.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Mba03_g04290.1 | orthology | 0.719 | 3 | - | - |
musac_pan_p016760 | orthology | 0.721 | 2 | - | - |
musac_pan_p042970 | orthology | 0.725 | 3 | - | - |
orysa_pan_p001816 | orthology | 0 | 1 | 300 | 1.54e-106 |