Gene ORGLA08G0123900.1


Sequence ID ORGLA08G0123900.1  add to my list
Species Oryza glaberrima
Alias No gene alias
Length 205aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 205 amino acids

>ORGLA08G0123900.1_ORYGL
MRAGGMLCRSQAATAVCVPGDARSMIVSRRADRTIAEDARLAHDVRYARLGAAASAGGAR
VPSRRFAAPRQAPTPPPPPPPPPQPPKQHRRPRRGAGVAVTLPMVTKSPKETPAREMAAA
AAAAKRAPLAAASPGDQVLQVVVMKVAIHCQGCAGKVRKHISKMEGVTSFSIDLESKKVT
VMGHVSPAGVLESISKVKKAELLFL




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP015837 Unannotated cluster
3 GP040905 Unannotated cluster
4 GP070656 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for ORGLA08G0123900.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Dr07514 orthology 0.629 3 144.4 6.9e-35
HORVU1Hr1G072500.1 orthology 0.153 4 217.6 8.2e-57
XP_008809313.1 orthology 0.665 6 164.9 9.1e-41
XP_010905917.1 orthology 0.664 7 157.1 2e-38
bradi_pan_p028136 orthology 0.171 3 268 1.82e-92
cocnu_pan_p015352 orthology 0.658 7 170 3.13e-54
musac_pan_p004339 orthology 0.717 4 - -
orysa_pan_p015149 orthology 0.0047 1 340 1.92e-120
orysa_pan_p029167 orthology 0.254 1 - -
tritu_pan_p039370 orthology 0.178 4 260 2.72e-89