Gene ORGLA08G0136300.1


Sequence ID ORGLA08G0136300.1  add to my list
Species Oryza glaberrima
Alias No gene alias
Length 84aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 84 amino acids

>ORGLA08G0136300.1_ORYGL
FSLQFYCMTVRMSIDCNGCYQRIRRALLQMQDLDSHLIDRKQQRVSVCGAFVPQDVAIKL
RKKTNRRVEILEIKEIDAGDGHRL




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP109350 Unannotated cluster
3 GP119142 Unannotated cluster
4 GP077996 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for ORGLA08G0136300.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Sspon.06G0021640-1B orthology 0.283 2 146.7 2e-35
Sspon.06G0021660-1B orthology 0.3 3 - -
Sspon.07G0031790-1C orthology 0.3 3 - -
bradi_pan_p016580 orthology 0.491 3 124 1.03e-38
musac_pan_p023320 orthology 0.695 4 124 4.64e-39
orysa_pan_p036324 orthology 0.001 1 172 5.87e-58