Gene ORGLA10G0119900.1


Sequence ID ORGLA10G0119900.1  add to my list
Species Oryza glaberrima
Alias No gene alias
Length 185aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 185 amino acids

>ORGLA10G0119900.1_ORYGL
MADIVSDVFLSFFCCCYYPPGGHRGVGAHNDTALRRRRGGAGRSSSRPPVSLQTVELKVR
MCCEGCERVVRSALANLRGVDSVEVDVAMEKVRVTGYVDRGRVLREVRRSGKKAEFWPSG
GTPRRFTSEKEYFRDGEAYRGSYNYHRRGYGDGDRHGRMREPARGADAVSNMFNDDDVSA
ACAIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP078604 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for ORGLA10G0119900.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
orysa_pan_p019824 orthology 0.0055 1 301 1.05e-105
tritu_pan_p003148 orthology 0.286 2 203 5.36e-67