Gene Oeu022024.1
Sequence ID | Oeu022024.1 add to my list | ||
---|---|---|---|
Species | Olea europaea | ||
Alias | No gene alias | ||
Length | 160aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 160 amino acids
>Oeu022024.1_OLEEU MEQWNKKKGEYTFVEITSLNPTCFNNSQTVDLKVRMCCTGCERVVKEAIQKLRGVDSIEV DLEMEKVTVIGYVDPKKVLKAVRRAGKRAEFWPYPNPPLYFTSTDNYFRDMTSEYKRSYN YWRHGYSAGDKHGTLPMGHRGDDKISNMFSDDNVYACYVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Oeu022024.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AUR62007086-RA | orthology | 0.483 | 2 | 184.9 | 6.7e-47 |
AUR62019949-RA | orthology | 0.492 | 2 | - | - |
Bv5_104360_dist.t1 | orthology | 0.454 | 2 | 186.4 | 1.3e-47 |