Gene Oeu026170.2


Sequence ID Oeu026170.2  add to my list
Species Olea europaea
Alias No gene alias
Length 131aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 131 amino acids

>Oeu026170.2_OLEEU
MNKSLKAVKKMKGFMCHSPASTAVCMNQDYMSVIVPRNLDRKIVDRAKLINNAKYIRLGE
PCKVSTTDHRRPINVSSLKKEKENGHQEVSSIAASHNVYQVVVMRVSLHCQGCAGKVKKH
LSKMEGIHFPS




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP015837 Unannotated cluster
3 GP040905 Unannotated cluster
4 GP070656 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Oeu026170.2



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
FvH4_5g30890.1 orthology 0.655 3 - -
cajca.ICPL87119.gnm1.ann1.C.cajan_22288.1 orthology 0.817 4 - -
cajca.ICPL87119.gnm1.ann1.C.cajan_22881.1 orthology 0.771 4 111.3 5.2e-25
cicar_pan_p022227 orthology 0.862 3 89.4 4.5e-24
cocnu_pan_p025689 orthology 0.564 2 - -
maldo_pan_p006499 orthology 0.847 3 - -
medtr_pan_p011208 orthology 0.834 3 104 2.77e-29
medtr_pan_p033339 orthology 0.875 3 - -
phavu.G19833.gnm2.ann1.Phvul.002G207200.1 orthology 0.774 4 108.2 4e-24
phavu.G19833.gnm2.ann1.Phvul.006G207900.1 orthology 0.942 4 - -
soybn_pan_p021093 orthology 0.752 3 - -
soybn_pan_p025312 orthology 0.794 3 112 1.42e-32
soybn_pan_p029731 orthology 0.787 3 - -