Gene Oeu029318.1
| Sequence ID | Oeu029318.1 add to my list | ||
|---|---|---|---|
| Species | Olea europaea | ||
| Alias | No gene alias | ||
| Length | 226aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 226 amino acids
>Oeu029318.1_OLEEU MHCEACARKVAKSLKGFQGVEGVTADYKASKVVVKGKTADPLKVCERIQKKSGRKVEIIS PLPKPPEEVKEETKEAPKNPEKKEEPPAIVTVVLKVRMHCEACAQVLQKRIRKVKGVESV TTDLANNHVIVKGVLDPDKLVSDVYKKTRKQASIVKDEEKKEEEKKVEEKKEEKEEKKEG EESKEEDDTKTEIKKSEYWPPPKYYMDYANPPQMFSDENPHACSVM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Oeu029318.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_14_162.1 | orthology | 0.391 | 4 | 210.3 | 3.4e-54 |
| Ca_32_762.1 | orthology | 0.455 | 4 | - | - |
| Ca_69_1.19 | orthology | 0.455 | 4 | - | - |
| Ca_78_26.1 | orthology | 0.391 | 4 | - | - |
| Ca_9_645.2 | orthology | 0.45 | 3 | - | - |
| Cc09_g00430 | orthology | 0.45 | 4 | 177.9 | 6.3e-45 |
| Cg2g046420.1 | orthology | 0.47 | 8 | - | - |
| Cm145580.1 | orthology | 0.687 | 7 | - | - |
| Cm298860.1 | orthology | 0.476 | 7 | - | - |
| Cs2g01750.1 | orthology | 0.47 | 8 | - | - |
| DCAR_002239 | orthology | 0.306 | 2 | 203 | 2.3e-52 |
| DCAR_030843 | orthology | 0.349 | 2 | - | - |
| FvH4_3g00420.1 | orthology | 0.434 | 8 | 180.3 | 1.4e-45 |
| HanXRQChr16g0515801 | orthology | 0.45 | 2 | - | - |
| MELO3C008010.2.1 | orthology | 0.577 | 7 | 214 | 1.66e-69 |
| Manes.09G082500.1 | orthology | 0.624 | 7 | - | - |
| Manes.S022000.1 | orthology | 0.397 | 7 | - | - |
| Oeu057024.1 | ultra-paralogy | 0.143 | 0 | - | - |
| PGSC0003DMP400023518 | orthology | 0.603 | 6 | - | - |
| PGSC0003DMP400026383 | orthology | 0.368 | 5 | 200.3 | 1.4e-51 |
| Solyc04g015030.2.1 | orthology | 0.376 | 5 | 228 | 3.25e-75 |
| Solyc11g012690.1.1 | orthology | 0.652 | 6 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_16695.1 | orthology | 0.445 | 6 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_24624.1 | orthology | 0.382 | 6 | 228 | 7.25e-76 |
| capan_pan_p012494 | orthology | 0.505 | 4 | - | - |
| capan_pan_p018045 | orthology | 0.618 | 5 | - | - |
| cicar_pan_p024449 | orthology | 0.402 | 5 | 248 | 2.29e-83 |
| cucsa_pan_p011686 | orthology | 0.565 | 7 | 205 | 6.49e-66 |
| ipotf_pan_p000797 | orthology | 0.39 | 5 | 247 | 1.21e-82 |
| itb01g10210.t2 | orthology | 0.396 | 5 | 245 | 5.29e-82 |
| maldo_pan_p012376 | orthology | 0.447 | 8 | - | - |
| maldo_pan_p020510 | orthology | 0.456 | 8 | 242 | 1.45e-80 |
| medtr_pan_p010658 | orthology | 0.388 | 5 | 231 | 2.97e-76 |
| phavu.G19833.gnm2.ann1.Phvul.003G086400.1 | orthology | 0.396 | 6 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.006G139700.1 | orthology | 0.433 | 6 | - | - |
| soybn_pan_p008938 | orthology | 0.377 | 5 | 244 | 9.95e-82 |
| soybn_pan_p009673 | orthology | 0.409 | 5 | - | - |
| soybn_pan_p024238 | orthology | 0.39 | 5 | - | - |
| thecc_pan_p018912 | orthology | 0.365 | 7 | - | - |
| vitvi_pan_p012828 | orthology | 0.425 | 6 | - | - |