Gene Oeu040283.1
Sequence ID | Oeu040283.1 add to my list | ||
---|---|---|---|
Species | Olea europaea | ||
Alias | No gene alias | ||
Length | 298aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 298 amino acids
>Oeu040283.1_OLEEU MKSIDLFCASPAATAICSSTDQCSTMPHGMKAVDRHIHRLGDWPKSRAPPPCSSQLPIDP RTYYQKNRKNSSKQSELFRRKSSADVNDLGSSSYLLSDKPLLDFTSDSERISALIPSNQP VRTERMDSDNFRVFKSLSTRSYESPPRNMPVKQYPVFKSSSKGTDENMLLKKYSSLVEKS SPTCSNDTKLPLRHLSNHLDIHKSSSTRPSHRSLKVVELRVSIHCKGCERKLRKHISRME GVASFKIDLPTKKVTIIGDVTPLSVLTSISKVKNAQFWPSPTSSSTPSSTPSRVGPTD
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP015837 | Unannotated cluster |
3 | GP040905 | Unannotated cluster |
4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Oeu040283.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Ca_4_477.7 | orthology | 0.546 | 3 | - | - |
Ca_84_91.1 | orthology | 0.536 | 4 | 218 | 2.1e-56 |
Cc01_g12180 | orthology | 0.535 | 4 | 218.4 | 5.5e-57 |
Oeu058521.1 | ultra-paralogy | 0.188 | 0 | - | - |
PGSC0003DMP400027269 | orthology | 0.485 | 3 | 218.8 | 5e-57 |
Solyc11g073020.1.1 | orthology | 0.481 | 3 | - | - |
capan_pan_p010270 | orthology | 0.439 | 2 | - | - |
ipotf_pan_p019321 | orthology | 0.823 | 4 | - | - |
ipotf_pan_p020149 | orthology | 0.702 | 4 | - | - |
itb07g12040.t1 | orthology | 0.807 | 4 | - | - |
itb14g16600.t1 | orthology | 0.687 | 4 | - | - |