Gene Oeu061475.1


Sequence ID Oeu061475.1  add to my list
Species Olea europaea
Alias No gene alias
Length 150aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 150 amino acids

>Oeu061475.1_OLEEU
MGVSGTMEFLSDLLSSAKKGKKKKQMNTVDLKVRMDCEGCARKVKKTLYEVKGAKSVEID
LKNQKASVTGFVDPKKVLKKAKATGKKSEPWPYVPYTMIAHPYVAGVYDKKAPPNYVRGT
NDPAVATLNPVEEQYTLMFSDDNPNACSIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463617 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Oeu061475.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Ca_51_149.3 orthology 0.321 3 - -
Ca_54_61.7 orthology 0.334 2 - -
Cc00_g30010 orthology 0.321 3 - -
Oeu024561.1 ultra-paralogy 0.142 0 - -
PGSC0003DMP400016735 orthology 0.378 4 - -
PGSC0003DMP400016737 orthology 0.371 4 - -
Solyc04g072700.2.1 orthology 0.371 4 - -
capan_pan_p000483 orthology 0.341 3 - -
ipotf_pan_p013731 orthology 0.288 3 246 3.4e-85
itb06g23970.t1 orthology 0.282 3 250 1.1e-66