Gene PGSC0003DMP400000761
| Sequence ID | PGSC0003DMP400000761 add to my list | ||
|---|---|---|---|
| Species | Solanum tuberosum | ||
| Alias | No gene alias | ||
| Length | 149aa | ||
| Gene Annotation | PGSC0003DMT400001032 Protein | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 149 amino acids
>PGSC0003DMP400000761_SOLTU MRKINFGKVLDCFSTLSSSGSCFCINQVGVHDDDDDGFEKKPLMNNNSLNQDDEHELMRL KDVINVGPPTLAFQLKPKIVVLRVSIHCNGCARKVEKHISKMEGVDMYQVDLETKKVVVI GDIIPFQVLESVSKVVKNVELSSWNTPEC
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP015837 | Unannotated cluster |
| 3 | GP040905 | Unannotated cluster |
| 4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for PGSC0003DMP400000761
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| capan_pan_p027184 | orthology | 0.154 | 1 | 241 | 3.32e-83 |
| ipotf_pan_p017293 | orthology | 0.467 | 3 | - | - |
| itb12g19630.t1 | orthology | 0.467 | 3 | 150.6 | 9.1e-37 |