Gene PGSC0003DMP400006528


Sequence ID PGSC0003DMP400006528  add to my list
Species Solanum tuberosum
Alias No gene alias
Length 159aa
Gene Annotation PGSC0003DMT400009390 Protein
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 159 amino acids

>PGSC0003DMP400006528_SOLTU
MGFLDHLSELCEFHRGTSRRKLSKLRRNQLETVEIRVKMDCEGCERRVRKSVEGMRGVTK
VEVEPKKHKLTVIGYVDPDKVLRRVRHRTGKKAEFWPYVPYDLVDHPYVRGVYDKKAPAG
YVRNVYDNPQASNLARASSTEVNYITAFSDENPQACMVM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463617 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for PGSC0003DMP400006528



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Ca_84_43.1 orthology 0.438 4 - -
Cc07_g11100 orthology 0.392 4 246.5 1e-65
HanXRQChr09g0256841 orthology 0.365 4 234.2 9.2e-62
Solyc02g083550.1.1 orthology 0.0424 2 319.3 1.4e-87
capan_pan_p026596 orthology 0.0936 1 297 3.75e-105