Gene PGSC0003DMP400010112
| Sequence ID | PGSC0003DMP400010112 add to my list | ||
|---|---|---|---|
| Species | Solanum tuberosum | ||
| Alias | No gene alias | ||
| Length | 149aa | ||
| Gene Annotation | PGSC0003DMT400014616 Protein | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 149 amino acids
>PGSC0003DMP400010112_SOLTU MSVLKVLDSVEFVTQRLHPPLVLDLFFFFSPPSLQLCCMVMRINIDCKGCYMKVSRALLT IPELETRFIEKNHSRVIVCGNFIPQDVAIKIRKKTNRRVEILEIQDLSGNDEPKQEEMPL ITSSDNQVETETYVTSQNPQPHMYFQVYR
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP109350 | Unannotated cluster |
| 3 | GP119142 | Unannotated cluster |
| 4 | GP077996 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for PGSC0003DMP400010112
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Bv5_110870_wcqq.t1 | orthology | 1 | 8 | 106.7 | 1.2e-23 |
| Bv5_110870_wcqq.t2 | orthology | 1 | 8 | - | - |
| CgUng002450.1 | orthology | 1 | 7 | 113.2 | 1.3e-25 |
| Cm118330.1 | orthology | 1 | 6 | 112.5 | 3.8e-25 |
| Cs7g26570.1 | orthology | 1 | 7 | 113.2 | 1.4e-25 |
| FvH4_5g12320.1 | orthology | 1 | 6 | 110.5 | 8.9e-25 |
| Manes.05G138100.1 | orthology | 0.83 | 3 | - | - |
| Solyc03g119630.2.1 | orthology | 0.0412 | 2 | 226.1 | 1.6e-59 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_35493.1 | orthology | 0.739 | 2 | 119.8 | 1.7e-27 |
| capan_pan_p000343 | orthology | 0.168 | 2 | 142 | 5.32e-45 |
| cicar_pan_p024669 | orthology | 0.977 | 3 | 119 | 1.05e-35 |
| cucsa_pan_p010693 | orthology | 1 | 8 | 105 | 3.25e-30 |
| maldo_pan_p026714 | orthology | 1 | 6 | - | - |
| medtr_pan_p036900 | orthology | 0.975 | 3 | 123 | 4.13e-37 |
| phavu.G19833.gnm2.ann1.Phvul.004G158700.1 | orthology | 0.806 | 2 | 125.2 | 3.6e-29 |
| soybn_pan_p040036 | orthology | 1 | 2 | - | - |
| soybn_pan_p040183 | orthology | 0.679 | 2 | - | - |
| soybn_pan_p040952 | orthology | 0.656 | 2 | 122 | 5.62e-37 |
| soybn_pan_p042566 | orthology | 0.738 | 2 | - | - |
| thecc_pan_p001600 | orthology | 1 | 7 | 118 | 1.58e-34 |
| vitvi_pan_p014384 | orthology | 0.949 | 6 | 117 | 6.09e-34 |