Gene PGSC0003DMP400010112


Sequence ID PGSC0003DMP400010112  add to my list
Species Solanum tuberosum
Alias No gene alias
Length 149aa
Gene Annotation PGSC0003DMT400014616 Protein
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 149 amino acids

>PGSC0003DMP400010112_SOLTU
MSVLKVLDSVEFVTQRLHPPLVLDLFFFFSPPSLQLCCMVMRINIDCKGCYMKVSRALLT
IPELETRFIEKNHSRVIVCGNFIPQDVAIKIRKKTNRRVEILEIQDLSGNDEPKQEEMPL
ITSSDNQVETETYVTSQNPQPHMYFQVYR





Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323
Heavy metal transport/detoxification protein superfamily
2 GP109350 Unannotated cluster
3 GP119142 Unannotated cluster
4 GP077996 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain superfamily
IPR036163
Heavy metal-associated domain superfamily Homologous_superfamily

IPR036163
Figure 1: IPR domains for PGSC0003DMP400010112



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Bv5_110870_wcqq.t1 orthology 1 8 106.7 1.2e-23
Bv5_110870_wcqq.t2 orthology 1 8 - -
CgUng002450.1 orthology 1 7 113.2 1.3e-25
Cm118330.1 orthology 1 6 112.5 3.8e-25
Cs7g26570.1 orthology 1 7 113.2 1.4e-25
FvH4_5g12320.1 orthology 1 6 110.5 8.9e-25
Manes.05G138100.1 orthology 0.83 3 - -
Solyc03g119630.2.1 orthology 0.0412 2 226.1 1.6e-59
cajca.ICPL87119.gnm1.ann1.C.cajan_35493.1 orthology 0.739 2 119.8 1.7e-27
capan_pan_p000343 orthology 0.168 2 142 5.32e-45
cicar_pan_p024669 orthology 0.977 3 119 1.05e-35
cucsa_pan_p010693 orthology 1 8 105 3.25e-30
maldo_pan_p026714 orthology 1 6 - -
medtr_pan_p036900 orthology 0.975 3 123 4.13e-37
phavu.G19833.gnm2.ann1.Phvul.004G158700.1 orthology 0.806 2 125.2 3.6e-29
soybn_pan_p040036 orthology 1 2 - -
soybn_pan_p040183 orthology 0.679 2 - -
soybn_pan_p040952 orthology 0.656 2 122 5.62e-37
soybn_pan_p042566 orthology 0.738 2 - -
thecc_pan_p001600 orthology 1 7 118 1.58e-34
vitvi_pan_p014384 orthology 0.949 6 117 6.09e-34