Gene PGSC0003DMP400010112
Sequence ID | PGSC0003DMP400010112 add to my list | ||
---|---|---|---|
Species | Solanum tuberosum | ||
Alias | No gene alias | ||
Length | 149aa | ||
Gene Annotation | PGSC0003DMT400014616 Protein | ||
Gene Ontology |
![]()
|
Length: 149 amino acids
>PGSC0003DMP400010112_SOLTU MSVLKVLDSVEFVTQRLHPPLVLDLFFFFSPPSLQLCCMVMRINIDCKGCYMKVSRALLT IPELETRFIEKNHSRVIVCGNFIPQDVAIKIRKKTNRRVEILEIQDLSGNDEPKQEEMPL ITSSDNQVETETYVTSQNPQPHMYFQVYR
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP109350 | Unannotated cluster |
3 | GP119142 | Unannotated cluster |
4 | GP077996 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for PGSC0003DMP400010112
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Bv5_110870_wcqq.t1 | orthology | 1 | 8 | 106.7 | 1.2e-23 |
Bv5_110870_wcqq.t2 | orthology | 1 | 8 | - | - |
CgUng002450.1 | orthology | 1 | 7 | 113.2 | 1.3e-25 |
Cm118330.1 | orthology | 1 | 6 | 112.5 | 3.8e-25 |
Cs7g26570.1 | orthology | 1 | 7 | 113.2 | 1.4e-25 |
FvH4_5g12320.1 | orthology | 1 | 6 | 110.5 | 8.9e-25 |
Manes.05G138100.1 | orthology | 0.83 | 3 | - | - |
Solyc03g119630.2.1 | orthology | 0.0412 | 2 | 226.1 | 1.6e-59 |
cajca.ICPL87119.gnm1.ann1.C.cajan_35493.1 | orthology | 0.739 | 2 | 119.8 | 1.7e-27 |
capan_pan_p000343 | orthology | 0.168 | 2 | 142 | 5.32e-45 |
cicar_pan_p024669 | orthology | 0.977 | 3 | 119 | 1.05e-35 |
cucsa_pan_p010693 | orthology | 1 | 8 | 105 | 3.25e-30 |
maldo_pan_p026714 | orthology | 1 | 6 | - | - |
medtr_pan_p036900 | orthology | 0.975 | 3 | 123 | 4.13e-37 |
phavu.G19833.gnm2.ann1.Phvul.004G158700.1 | orthology | 0.806 | 2 | 125.2 | 3.6e-29 |
soybn_pan_p040036 | orthology | 1 | 2 | - | - |
soybn_pan_p040183 | orthology | 0.679 | 2 | - | - |
soybn_pan_p040952 | orthology | 0.656 | 2 | 122 | 5.62e-37 |
soybn_pan_p042566 | orthology | 0.738 | 2 | - | - |
thecc_pan_p001600 | orthology | 1 | 7 | 118 | 1.58e-34 |
vitvi_pan_p014384 | orthology | 0.949 | 6 | 117 | 6.09e-34 |