Gene PGSC0003DMP400016737


Sequence ID PGSC0003DMP400016737  add to my list
Species Solanum tuberosum
Alias No gene alias
Length 150aa
Gene Annotation PGSC0003DMT400024481 Protein
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 150 amino acids

>PGSC0003DMP400016737_SOLTU
MGVSGTLEYLSEVFSNVKKSKKKKQIATVSIKIRMDCEGCARKVKNALSKVKGAKSVDVD
LKQQKATVTGFVEPKKVLKAAQSTGKKCEIWPYVPYSMVAHPYAAGVYDKKAPPNFVRAT
TDPSVAHLNPVEEQYSLMFSDENPNACNIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463617 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for PGSC0003DMP400016737



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Ca_51_149.3 orthology 0.398 6 220.7 1.7e-57
Ca_54_61.7 orthology 0.412 5 - -
Cc00_g30010 orthology 0.398 6 220.7 5.6e-58
Oeu024561.1 orthology 0.34 4 243.4 1.4e-64
Oeu061475.1 orthology 0.371 4 - -
PGSC0003DMP400016735 ultra-paralogy 0.0202 0 - -
Solyc04g072700.2.1 orthology 0.0139 1 297 7.2e-81
capan_pan_p000483 orthology 0.0487 2 285 1.02e-100
ipotf_pan_p013731 orthology 0.239 4 246 1.75e-85
itb06g23970.t1 orthology 0.233 4 248.4 3.2e-66