Gene PGSC0003DMP400019266
| Sequence ID | PGSC0003DMP400019266 add to my list |
|---|---|
| Species | Solanum tuberosum |
| Alias | No gene alias |
| Length | 57aa |
| Gene Annotation | PGSC0003DMT400028294 Protein |
Length: 57 amino acids
>PGSC0003DMP400019266_SOLTU MHLIEKQEKRISIMGRFDPADIAIRIRKKMNRRVEILDIQLPQQPDEMHHAPIMQHT
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP109350 | Unannotated cluster |
| 3 | GP119142 | Unannotated cluster |
| 4 | GP077996 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Solyc05g016190.2.1 | orthology | 0.129 | 1 | 84 | 3.7e-17 |
| capan_pan_p026342 | orthology | 0.457 | 2 | 85.9 | 9.11e-24 |
| ipotf_pan_p021199 | orthology | 1 | 4 | - | - |
| ipotf_pan_p028439 | orthology | 0.9 | 4 | - | - |
| itb07g07960.t1 | orthology | 1 | 4 | - | - |
| itb14g01920.t1 | orthology | 0.9 | 4 | - | - |