Gene PGSC0003DMP400022303
| Sequence ID | PGSC0003DMP400022303 add to my list | ||
|---|---|---|---|
| Species | Solanum tuberosum | ||
| Alias | No gene alias | ||
| Length | 168aa | ||
| Gene Annotation | PGSC0003DMT400032793 Protein | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 168 amino acids
>PGSC0003DMP400022303_SOLTU MRGFMCQPQVSTAVCLSCDSRSVVVPAARRRMSMEDHTKLINKCKRLGDVPRTLGSMPIS KRSRNVAAAAGSSVLTISKRDQENGCKIVPSIPFTDNSFQVVVMRVSLHCQGCAGKVKKH LSKMEGVTSFSIDLDSQRVTVMGHVSPVGVLESISKVKRAEFWPLNSC
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP015837 | Unannotated cluster |
| 3 | GP040905 | Unannotated cluster |
| 4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for PGSC0003DMP400022303
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Bv8_190260_chqz.t1 | orthology | 0.784 | 3 | 118.2 | 4.5e-27 |
| Solyc01g105000.2.1 | orthology | 0.0863 | 2 | 296.6 | 1.1e-80 |
| capan_pan_p019823 | orthology | 0.0745 | 1 | 292 | 4.8e-103 |
| capan_pan_p036114 | orthology | 0.199 | 1 | - | - |
| capan_pan_p041384 | orthology | 0.19 | 1 | - | - |
| evm_27.model.AmTr_v1.0_scaffold00010.206 | orthology | 0.795 | 4 | 141.7 | 3.1e-34 |