Gene PGSC0003DMP400023518
Sequence ID | PGSC0003DMP400023518 add to my list | ||
---|---|---|---|
Species | Solanum tuberosum | ||
Alias | No gene alias | ||
Length | 238aa | ||
Gene Annotation | PGSC0003DMT400034600 Protein | ||
Gene Ontology |
![]()
|
Length: 238 amino acids
>PGSC0003DMP400023518_SOLTU MGEEKREEEEAQEMVLKVDMHCEGCARKVARALKGFQGVEEVTMDYKESRVVVKGKNVDP LKVCERVERKSGRKVELISHMTKPFEENTKEEEIKKEEEPKQEKKDEPLPEVTLVLNVQM HCDACALVLQKKIRKIKGVECVTTDVEKSRVIVKGVNINPEKLVNDVYKRSGKQVSVVNN IIQEKKEEEEKQKEEEEEDTIIKNYNLAQKYNYNNMEYYANYSPQIFSDDNPHACSLM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for PGSC0003DMP400023518
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Ca_14_162.1 | orthology | 0.671 | 5 | - | - |
Ca_32_762.1 | orthology | 0.735 | 5 | - | - |
Ca_69_1.19 | orthology | 0.735 | 5 | - | - |
Ca_78_26.1 | orthology | 0.671 | 5 | - | - |
Ca_9_645.2 | orthology | 0.731 | 4 | - | - |
Cc09_g00430 | orthology | 0.73 | 5 | - | - |
Cg2g046420.1 | orthology | 0.802 | 11 | - | - |
Cm145580.1 | orthology | 1 | 10 | - | - |
Cm298860.1 | orthology | 0.808 | 10 | - | - |
Cs2g01750.1 | orthology | 0.802 | 11 | - | - |
DCAR_002239 | orthology | 0.678 | 7 | - | - |
DCAR_030843 | orthology | 0.72 | 7 | - | - |
FvH4_3g00420.1 | orthology | 0.766 | 11 | - | - |
HanXRQChr16g0515801 | orthology | 0.821 | 7 | - | - |
MELO3C008010.2.1 | orthology | 0.909 | 10 | - | - |
Manes.09G082500.1 | orthology | 0.956 | 10 | - | - |
Manes.S022000.1 | orthology | 0.729 | 10 | - | - |
Oeu029318.1 | orthology | 0.603 | 6 | - | - |
Oeu057024.1 | orthology | 0.642 | 6 | - | - |
Solyc11g012690.1.1 | orthology | 0.168 | 1 | 280.4 | 1.1e-75 |
cajca.ICPL87119.gnm1.ann1.C.cajan_16695.1 | orthology | 0.777 | 9 | - | - |
cajca.ICPL87119.gnm1.ann1.C.cajan_24624.1 | orthology | 0.714 | 9 | - | - |
capan_pan_p018045 | orthology | 0.228 | 2 | 224 | 2.19e-74 |
cicar_pan_p024449 | orthology | 0.734 | 8 | - | - |
cucsa_pan_p011686 | orthology | 0.897 | 10 | - | - |
ipotf_pan_p000797 | orthology | 0.499 | 4 | - | - |
itb01g10210.t2 | orthology | 0.505 | 4 | - | - |
maldo_pan_p012376 | orthology | 0.779 | 11 | - | - |
maldo_pan_p020510 | orthology | 0.788 | 11 | - | - |
medtr_pan_p010658 | orthology | 0.72 | 8 | - | - |
phavu.G19833.gnm2.ann1.Phvul.003G086400.1 | orthology | 0.728 | 9 | - | - |
phavu.G19833.gnm2.ann1.Phvul.006G139700.1 | orthology | 0.765 | 9 | - | - |
soybn_pan_p008938 | orthology | 0.709 | 8 | - | - |
soybn_pan_p009673 | orthology | 0.741 | 8 | - | - |
soybn_pan_p024238 | orthology | 0.722 | 8 | - | - |
thecc_pan_p018912 | orthology | 0.697 | 10 | - | - |
vitvi_pan_p012828 | orthology | 0.757 | 9 | - | - |