Gene PGSC0003DMP400035470
| Sequence ID | PGSC0003DMP400035470 add to my list |
|---|---|
| Species | Solanum tuberosum |
| Alias | No gene alias |
| Length | 115aa |
| Gene Annotation | PGSC0003DMT400052612 Protein |
Length: 115 amino acids
>PGSC0003DMP400035470_SOLTU MAMQKVTVTGWADQKKILKTVRRTGKRAEIWQFPHNPEMRNNPSYVTDHYYQQQGSSGPA TYYAGEPPASAYNYRKHGYDNYGRAYSLYRGNSNTFGSRVGDAFSDENPRGCNIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Cc05_g08310 | orthology | 0.647 | 5 | 123.6 | 7.2e-29 |
| Oeu042935.1 | orthology | 0.554 | 4 | 138.7 | 3.7e-33 |
| Solyc07g055010.2.1 | orthology | 0.0372 | 1 | 237.3 | 5.2e-63 |
| capan_pan_p019104 | orthology | 0.081 | 2 | 219 | 2.77e-75 |
| ipotf_pan_p020842 | orthology | 0.387 | 4 | 152 | 5.45e-49 |
| itb02g08570.t1 | orthology | 0.393 | 4 | 151.8 | 3.2e-37 |