Gene PGSC0003DMP400038366
| Sequence ID | PGSC0003DMP400038366 add to my list |
|---|---|
| Species | Solanum tuberosum |
| Alias | No gene alias |
| Length | 162aa |
| Gene Annotation | PGSC0003DMT400057071 Protein |
Length: 162 amino acids
>PGSC0003DMP400038366_SOLTU MKMVDVLSSICGVYSVTIDSEDGTAKISGEVDPNLLLRALSRSGLGNHAEVKWVRLKHPM LSNSHMTDGYGSYNHGYGSHNHGYGSYNQGYGYNSYGHGHGHGYSSIGGPFMQRRSLPEY NYGYEGHHNYQYPFRGTAQDSYATNYYPGALPSPRPYNSYYM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP241299 | Unannotated cluster |
| 3 | GP344409 | Unannotated cluster |
| 4 | GP490191 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Oeu049387.1 | orthology | 0.746 | 3 | 92 | 5.6e-19 |
| Solyc07g065430.2.1 | orthology | 0.0108 | 1 | 250.8 | 6.4e-67 |
| capan_pan_p030197 | orthology | 0.234 | 2 | 194 | 1.26e-64 |
| ipotf_pan_p003402 | orthology | 1 | 4 | 97.1 | 5.66e-26 |
| ipotf_pan_p021052 | orthology | 1 | 5 | - | - |
| itb02g23000.t1 | orthology | 1 | 5 | - | - |
| itb02g24290.t1 | orthology | 1 | 4 | - | - |