Gene PGSC0003DMP400040663


Sequence ID PGSC0003DMP400040663  add to my list
Species Solanum tuberosum
Alias No gene alias
Length 81aa
Gene Annotation PGSC0003DMT400060399 Protein
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 81 amino acids

>PGSC0003DMP400040663_SOLTU
MSQTVVLKVGMSCEGCVGAVKRVLGKMEGVETFDIDLKEQKVTVKGNVQPDAVLKTVSKT
GKPTSFWEAGESAQTEAVSTA




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP239638 Unannotated cluster
3 GP341755 Unannotated cluster
4 GP463817 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for PGSC0003DMP400040663



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Cg1g022220.1 orthology 0.281 5 - -
Cg3g009570.1 orthology 0.282 4 - -
Cg7g009800.1 orthology 0.221 5 131.7 2e-31
Cm109130.1 orthology 0.234 5 131.3 4.3e-31
Cm121490.1 orthology 0.266 4 - -
Cs2g08850.1 orthology 0.281 5 - -
HanXRQChr07g0194221 orthology 0.774 4 - -
HanXRQChr08g0217841 orthology 0.385 4 - -
HanXRQChr11g0322281 orthology 0.677 4 - -
HanXRQChr12g0368131 orthology 0.385 4 124.4 5.3e-29
Solyc05g055310.2.1 orthology 0 1 158.3 2.2e-39
capan_pan_p024732 orthology 0.0588 2 138 6.32e-45
orange1.1t01168.1 orthology 0.25 5 129.8 8.1e-31
orange1.1t01542.2 orthology 0.249 5 - -