Gene PGSC0003DMP400045992
Sequence ID | PGSC0003DMP400045992 add to my list | ||
---|---|---|---|
Species | Solanum tuberosum | ||
Alias | No gene alias | ||
Length | 326aa | ||
Gene Annotation | PGSC0003DMT400068079 Protein | ||
Gene Ontology |
Display term(s) (1)
|
Length: 326 amino acids
>PGSC0003DMP400045992_SOLTU MGEEEKKPAEEVKKTEGEKKEDAPKSDEKTEEKKTEEAPAPPPPPQEIVLRVYMHCEGCA RKVRKSLKGFQGVEDVLTDCKSHKVVVKGEKADPLKVLERVQKKSHRKVELLSPIPKPPA EEAKKPEEKEVVKPEEKKEEPPQVITVVLKVHMHCEACSQEIKRRIQKMKGVENAEPDLK NSQVSVKGIFEATQLVDYVSRRTGKRAVIVKVEPEKKGEEKPKEEKKTEEGEKDAKKAEE EEKKANGGDSASAVTAAAPSEGAANKEVGVQEEDPKLEMKKNEFYYYYPQQPNYHLYPQT YASHEMYNPYPPQMFSDENPNACSVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for PGSC0003DMP400045992
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Solyc03g097380.2.1 | orthology | 0.0625 | 1 | 298.1 | 7e-81 |
capan_pan_p023481 | orthology | 0.156 | 2 | 307 | 3.34e-104 |
ipotf_pan_p012033 | orthology | 0.412 | 4 | 261 | 1.32e-85 |
ipotf_pan_p015819 | orthology | 0.424 | 4 | - | - |
itb02g17790.t1 | orthology | 0.4 | 4 | - | - |
itb11g13550.t1 | orthology | 0.444 | 4 | 228.4 | 7.5e-60 |