Gene PGSC0003DMP400046920
| Sequence ID | PGSC0003DMP400046920 add to my list |
|---|---|
| Species | Solanum tuberosum |
| Alias | No gene alias |
| Length | 102aa |
| Gene Annotation | PGSC0003DMT400069507 Protein |
Length: 102 amino acids
>PGSC0003DMP400046920_SOLTU MINLGVRTAETDLTLGKVIVKGSMDANKLVDYLYRRTKKQAKIVLQHEPRKHKEEPKSED PNPDEEAKKLEEEDKKEGGEDSNMASEGEEIINKMMYYCQPL
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP126431 | Unannotated cluster |
| 4 | GP077890 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| HanXRQChr14g0448911 | orthology | 1 | 1 | - | - |
| Solyc06g073070.1.1 | orthology | 0.47 | 3 | - | - |
| capan_pan_p006811 | orthology | 0.225 | 2 | - | - |