Gene PGSC0003DMP400055391


Sequence ID PGSC0003DMP400055391  add to my list
Species Solanum tuberosum
Alias No gene alias
Length 291aa
Gene Annotation PGSC0003DMT400081991 Protein



Length: 291 amino acids

>PGSC0003DMP400055391_SOLTU
MAMMNPENEDFDPETESESEDEEGDQQVVKLAEPSKTAVYNRDGLLERLADISWPDDLDW
THRLSINREEQEEVDVNDDLAREHSFYTQGLEGIRQAYVNFQSTGEPFLRPSDYYAEMVK
SDTHMEKVKGRLLAEKRRIEESEERRKARDNKKLAKDVQAQKMKERTKQKKQEIESVKKW
RKQRQQSGFDKEDAGGLDLAFNGGNADKPYQRSNKKRPGVSPGDRSGGKTTFGGKGKGFD
KKRKSREFKDSKFGFGGRKGLKKQNTADTTNDFGGFHKGDRSAKNNKRVKR





Clustering Level Family ID Family Name
1
Unknown function duf1138 family
GP002478
Unknown function duf1138 family
2 GP018276 Unannotated cluster
3 GP042981 Unannotated cluster
4 GP075980 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Eukaryotic rRNA processing
IPR008610
Eukaryotic rRNA processing Family

IPR008610
Figure 1: IPR domains for PGSC0003DMP400055391



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
AT3G22660.1 orthology 0.589 5 221.9 5.3e-58
PGSC0003DMP400055292 ultra-paralogy 0.0222 0 - -
Solyc01g006090.2.1 orthology 0.0264 1 - -
brana_pan_p006433 orthology 0.571 6 - -
brana_pan_p007884 orthology 0.569 7 286 1.3e-96
brana_pan_p012403 orthology 0.564 6 - -
brana_pan_p034179 orthology 0.552 6 - -
braol_pan_p022657 orthology 0.55 6 279 1.53e-93
braol_pan_p024061 orthology 0.611 7 - -
braol_pan_p030426 orthology 0.571 6 - -
brarr_pan_p009571 orthology 0.552 6 - -
brarr_pan_p026538 orthology 0.559 5 293 2.71e-99
brarr_pan_p031703 orthology 0.558 6 - -
capan_pan_p017109 orthology 0.188 2 288 5.7e-98
ipotf_pan_p017885 orthology 0.449 4 - -
ipotf_pan_p024335 orthology 0.724 3 - -
ipotf_pan_p027028 orthology 0.492 3 - -
itb11g17740.t1 orthology 0.441 3 - -
itb12g07110.t1 orthology 0.446 4 - -