Gene Solyc01g111600.2.1
Sequence ID | Solyc01g111600.2.1 add to my list | ||
---|---|---|---|
Species | Solanum lycopersicum | ||
Alias | No gene alias | ||
Length | 153aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 153 amino acids
>Solyc01g111600.2.1_SOLLC MGVLDHISDMFDCSSEHSKHKRRKQLQTVEIKVKMDCEGCERKVRRSVEGMKGVSSVTIE PKQHKLTVVGYVDPEKVVSRVAHRTGKKAEIWPYVPYDVVAHPYAQGVYDKKAPAGYVRR DDFQTNQLARASSTEVRYTTAFSDENPAACVVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Solyc01g111600.2.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
HanXRQChr10g0300861 | orthology | 0.259 | 2 | 252.7 | 2.4e-67 |
HanXRQChr13g0397081 | orthology | 0.251 | 2 | 256 | 6.94e-89 |
capan_pan_p014003 | orthology | 0.013 | 1 | 311 | 7.71e-111 |
ipotf_pan_p020143 | orthology | 0.133 | 4 | 281 | 6.14e-99 |
itb10g25800.t1 | orthology | 0.133 | 4 | 279.6 | 1.3e-75 |