Gene Solyc01g111600.2.1


Sequence ID Solyc01g111600.2.1  add to my list
Species Solanum lycopersicum
Alias No gene alias
Length 153aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 153 amino acids

>Solyc01g111600.2.1_SOLLC
MGVLDHISDMFDCSSEHSKHKRRKQLQTVEIKVKMDCEGCERKVRRSVEGMKGVSSVTIE
PKQHKLTVVGYVDPEKVVSRVAHRTGKKAEIWPYVPYDVVAHPYAQGVYDKKAPAGYVRR
DDFQTNQLARASSTEVRYTTAFSDENPAACVVM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463617 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Solyc01g111600.2.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
HanXRQChr10g0300861 orthology 0.259 2 252.7 2.4e-67
HanXRQChr13g0397081 orthology 0.251 2 256 6.94e-89
capan_pan_p014003 orthology 0.013 1 311 7.71e-111
ipotf_pan_p020143 orthology 0.133 4 281 6.14e-99
itb10g25800.t1 orthology 0.133 4 279.6 1.3e-75