Gene Solyc03g119630.2.1
| Sequence ID | Solyc03g119630.2.1 add to my list | ||
|---|---|---|---|
| Species | Solanum lycopersicum | ||
| Alias | No gene alias | ||
| Length | 118aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 118 amino acids
>Solyc03g119630.2.1_SOLLC MTQKLCCMVMRINIDCKGCYMKVSRALLTIPELETRFIEKNHSRVIVCGNFIPQDVAIKI RKKTNRRVEILEIQDLSGNDEQKQEEMPLITSCDNQVETETHVTSQNPQPHMYFQVYR
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP109350 | Unannotated cluster |
| 3 | GP119142 | Unannotated cluster |
| 4 | GP077996 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Solyc03g119630.2.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Bv5_110870_wcqq.t1 | orthology | 1 | 9 | 107.5 | 5.6e-24 |
| Bv5_110870_wcqq.t2 | orthology | 1 | 9 | - | - |
| CgUng002450.1 | orthology | 1 | 8 | 111.7 | 3e-25 |
| Cm118330.1 | orthology | 1 | 7 | 108.6 | 4.3e-24 |
| Cs7g26570.1 | orthology | 1 | 8 | 111.7 | 3.3e-25 |
| FvH4_5g12320.1 | orthology | 1 | 7 | 113.6 | 8.3e-26 |
| Manes.05G138100.1 | orthology | 0.87 | 4 | - | - |
| PGSC0003DMP400010112 | orthology | 0.0412 | 2 | 225.3 | 2.1e-59 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_35493.1 | orthology | 0.779 | 3 | 119.4 | 1.7e-27 |
| capan_pan_p000343 | orthology | 0.152 | 1 | 144 | 2e-46 |
| cicar_pan_p024669 | orthology | 1 | 4 | 118 | 9.63e-36 |
| cucsa_pan_p010693 | orthology | 1 | 9 | 108 | 9.38e-32 |
| maldo_pan_p026714 | orthology | 1 | 7 | - | - |
| medtr_pan_p036900 | orthology | 1 | 4 | 125 | 1.61e-38 |
| phavu.G19833.gnm2.ann1.Phvul.004G158700.1 | orthology | 0.846 | 3 | 119.4 | 1.6e-27 |
| soybn_pan_p040036 | orthology | 1 | 3 | - | - |
| soybn_pan_p040183 | orthology | 0.72 | 3 | - | - |
| soybn_pan_p040952 | orthology | 0.697 | 3 | 125 | 2.19e-38 |
| soybn_pan_p042566 | orthology | 0.778 | 3 | - | - |
| thecc_pan_p001600 | orthology | 1 | 8 | 118 | 3.6e-35 |
| vitvi_pan_p014384 | orthology | 0.989 | 7 | 117 | 2.77e-34 |