Gene Solyc04g015030.2.1
| Sequence ID | Solyc04g015030.2.1 add to my list | ||
|---|---|---|---|
| Species | Solanum lycopersicum | ||
| Alias | No gene alias | ||
| Length | 272aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 272 amino acids
>Solyc04g015030.2.1_SOLLC MGEEKENKGEEVKKEEEKKEEEKKVEGKKEDEIQEIVLKVDMHCEACARKVARSLKGFQG VEEVKADSKASKVVIKGKNADPLKVCERIQKKSGRKVELISPLPKPPEENKKEEEEEKLP KVEEKKDEPPPVITVKMTVQMHCEACAQVLQKRIRKIQGVESVTTDLGNNQVVVKGVVDP EKLANDVYKRTGKQAMVVKEEEVKKEEEKKEEEKKEEKKESGEEKGKEEDDKTTIDIKKN EYMTQRDYIFMEYANYSPQIFSDENPNACSIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Solyc04g015030.2.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_14_162.1 | orthology | 0.444 | 4 | 210.3 | 4.1e-54 |
| Ca_32_762.1 | orthology | 0.508 | 4 | - | - |
| Ca_69_1.19 | orthology | 0.508 | 4 | - | - |
| Ca_78_26.1 | orthology | 0.444 | 4 | - | - |
| Ca_9_645.2 | orthology | 0.503 | 3 | - | - |
| Cc09_g00430 | orthology | 0.503 | 4 | 166.8 | 1.7e-41 |
| Cg2g046420.1 | orthology | 0.574 | 10 | 205.3 | 4.6e-53 |
| Cm145580.1 | orthology | 0.791 | 9 | - | - |
| Cm298860.1 | orthology | 0.58 | 9 | - | - |
| Cs2g01750.1 | orthology | 0.574 | 10 | 215.7 | 3.7e-56 |
| DCAR_002239 | orthology | 0.45 | 6 | - | - |
| DCAR_030843 | orthology | 0.493 | 6 | 214.5 | 9.1e-56 |
| FvH4_3g00420.1 | orthology | 0.539 | 10 | 213.4 | 1.8e-55 |
| HanXRQChr16g0515801 | orthology | 0.594 | 6 | 187.2 | 2.2e-47 |
| MELO3C008010.2.1 | orthology | 0.681 | 9 | 203.8 | 1.2e-52 |
| Manes.09G082500.1 | orthology | 0.728 | 9 | 207 | 3.31e-66 |
| Manes.S022000.1 | orthology | 0.501 | 9 | - | - |
| Oeu029318.1 | orthology | 0.376 | 5 | 236 | 2.69e-78 |
| Oeu057024.1 | orthology | 0.414 | 5 | 199.9 | 3.2e-51 |
| PGSC0003DMP400026383 | orthology | 0.0423 | 1 | 312.4 | 3e-85 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_16695.1 | orthology | 0.55 | 8 | 204.9 | 7.2e-53 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_24624.1 | orthology | 0.487 | 8 | - | - |
| capan_pan_p012494 | orthology | 0.229 | 2 | 189 | 1.67e-60 |
| cicar_pan_p024449 | orthology | 0.507 | 7 | 224 | 4.26e-73 |
| cucsa_pan_p011686 | orthology | 0.67 | 9 | 227 | 6.17e-74 |
| maldo_pan_p012376 | orthology | 0.551 | 10 | - | - |
| maldo_pan_p020510 | orthology | 0.561 | 10 | 245 | 4.93e-81 |
| medtr_pan_p010658 | orthology | 0.492 | 7 | 230 | 3.23e-75 |
| phavu.G19833.gnm2.ann1.Phvul.003G086400.1 | orthology | 0.501 | 8 | 210.3 | 1.5e-54 |
| phavu.G19833.gnm2.ann1.Phvul.006G139700.1 | orthology | 0.538 | 8 | - | - |
| soybn_pan_p008938 | orthology | 0.481 | 7 | - | - |
| soybn_pan_p009673 | orthology | 0.513 | 7 | - | - |
| soybn_pan_p024238 | orthology | 0.494 | 7 | 250 | 4.94e-83 |
| thecc_pan_p018912 | orthology | 0.469 | 9 | 239 | 1.01e-78 |
| vitvi_pan_p012828 | orthology | 0.529 | 8 | 254 | 5.8e-85 |