Gene Solyc04g072700.2.1


Sequence ID Solyc04g072700.2.1  add to my list
Species Solanum lycopersicum
Alias No gene alias
Length 150aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 150 amino acids

>Solyc04g072700.2.1_SOLLC
MGVSGTLEYLSEVLSNVKKSKKKKQIATVSIKIRMDCEGCARKVKNALSKVKGAKSVDVD
LKQQKATVTGFVEPKKVLKAAKSTGKKCEIWPYVPYSMVAHPYAAGVYDKKAPPNFVRAT
TDPSVAHLNPVEEQYSLMFSDENPNACNIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463617 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Solyc04g072700.2.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Ca_51_149.3 orthology 0.398 6 221.1 1.3e-57
Ca_54_61.7 orthology 0.411 5 - -
Cc00_g30010 orthology 0.398 6 221.1 4.3e-58
Oeu024561.1 orthology 0.339 4 245.7 2.8e-65
Oeu061475.1 orthology 0.371 4 - -
PGSC0003DMP400016735 orthology 0.0207 1 - -
PGSC0003DMP400016737 orthology 0.0139 1 296.2 1.2e-80
capan_pan_p000483 orthology 0.0481 2 285 1.44e-100
ipotf_pan_p013731 orthology 0.238 4 249 1.5e-86
itb06g23970.t1 orthology 0.232 4 250.8 6.5e-67