Gene Solyc05g051820.2.1


Sequence ID Solyc05g051820.2.1  add to my list
Species Solanum lycopersicum
Alias No gene alias
Length 154aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 154 amino acids

>Solyc05g051820.2.1_SOLLC
MGLGGTLEYIYDMMKISHKSNNKKRQFHTVELKIRMDCDGCELKVKKTLSSISGVKSVEI
NRKQQKVTVTGYVEANKVLKKAKSTGKKAEIWPYVPYNLVAQPYAVASYDKKAPPGYVRR
VDHNMTTIGTISRFEDHDYVTMFSDDNPNACFIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463617 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Solyc05g051820.2.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
PGSC0003DMP400037825 orthology 0.0669 1 294.3 4.8e-80
capan_pan_p020108 orthology 0.144 2 265 8.19e-93
ipotf_pan_p006080 orthology 0.259 4 - -
itb12g00660.t1 orthology 0.246 4 - -