Gene Solyc10g039390.1.1


Sequence ID Solyc10g039390.1.1  add to my list
Species Solanum lycopersicum
Alias No gene alias
Length 214aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 214 amino acids

>Solyc10g039390.1.1_SOLLC
MSIEEKKIEVTSAVYRVGLHCPKCAHDIRKPLLATQGVHNVDVKFDEDEVTVKGAIDANK
IHQRLQKWTKNKVHLVSHAKIENANQLKKETIKTTILKVYMHCNKCEVDLERRLLKHKGI
NSVKTNFKAQTITVETILESEKLVSYVTKTFGKYTEIIKKKEEEKVTMEEKIIEFKQVKK
VEAKIKEGEIPCSVYYVYAPPWFSDENPNACHVM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015545		 Heavy metal transport/detoxification group1
3 GP342504 Unannotated cluster
4 GP464372 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Solyc10g039390.1.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Ca_46_563.1 orthology 0.564 5 - -
Ca_64_447.2 orthology 0.56 6 206.8 3.6e-53
Cc02_g26130 orthology 0.56 6 229.9 1.3e-60
DCAR_029550 orthology 0.714 5 221.1 7.6e-58
HanXRQChr06g0168381 orthology 0.793 6 162.5 4.6e-40
Oeu036922.1 orthology 0.544 5 - -
PGSC0003DMP400011529 orthology 0.136 1 325.1 3.5e-89
capan_pan_p023451 orthology 0.331 2 164 3.02e-52
ipotf_pan_p011107 orthology 0.428 4 258 1.32e-87
itb09g19040.t1 orthology 0.452 4 161.8 5.7e-40