Gene Sspon.01G0001200-2B
| Sequence ID | Sspon.01G0001200-2B add to my list | ||
|---|---|---|---|
| Species | Saccharum spontaneum | ||
| Alias | No gene alias | ||
| Length | 194aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 194 amino acids
>Sspon.01G0001200-2B_SACSP MSVSSSLSNFLLCCFYPSATHRHGHRGGAYYYSSHPTSTNTLYYHEGPFAGRRMGRSSRP LSLQTVELKVRMCCSGCERVVKHAVSRLRGVDSVEVDVEMEKVTVTGYVDRHRVLKEVRR AGKKAEFWPNPDLPLHFTSAKDYFHDEESYRRTYNYYRHGYNGDKHGQLHEPHRGADPVS NMFNDDDVNACSIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Sspon.01G0001200-2B
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Sspon.01G0001200-4D | ultra-paralogy | 0.0052 | 0 | - | - |
| maize_pan_p007146 | orthology | 0.0546 | 2 | - | - |
| sorbi_pan_p008100 | orthology | 0.0108 | 2 | - | - |