Gene Sspon.02G0007720-2B
Sequence ID | Sspon.02G0007720-2B add to my list |
---|---|
Species | Saccharum spontaneum |
Alias | No gene alias |
Length | 220aa |
Length: 220 amino acids
>Sspon.02G0007720-2B_SACSP MDDVDSDVEESDSEDDSGEEAQDKPSDKAIYNKEAILEKLEDIAWPKNVDWMHKLTIEHD QGEKVDVNDDLARELAFYTQALDGTRQAFEKLQSMKVRFLRPTDYYAEMVKTDAHMHKIK GRLLSEKKRIEEAEERRKARESRKKAKEVQAEKKKERAKQKKEQIESVKKWRKQRQQGGF TKGNDDVPDLNFEGEEGFKQSKKKRPGVSPGDRSGGLAKR
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Unknown function duf1138 family
GP002478 |
Unknown function duf1138 family |
2 | GP018276 | Unannotated cluster |
3 | GP042981 | Unannotated cluster |
4 | GP075980 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Eukaryotic rRNA processing
IPR008610
|
Eukaryotic rRNA processing | Family |
Figure 1: IPR domains for Sspon.02G0007720-2B
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Sspon.02G0007720-1A | ultra-paralogy | 0.034 | 0 | - | - |
Sspon.02G0007720-1P | ultra-paralogy | 0.0024 | 0 | - | - |
Sspon.02G0007720-3C | ultra-paralogy | 0.0079 | 0 | - | - |
Sspon.02G0007720-4D | ultra-paralogy | 0.0189 | 0 | - | - |
maize_pan_p000100 | orthology | 0.0264 | 1 | - | - |