Gene Sspon.02G0007720-2B
| Sequence ID | Sspon.02G0007720-2B add to my list |
|---|---|
| Species | Saccharum spontaneum |
| Alias | No gene alias |
| Length | 220aa |
Length: 220 amino acids
>Sspon.02G0007720-2B_SACSP MDDVDSDVEESDSEDDSGEEAQDKPSDKAIYNKEAILEKLEDIAWPKNVDWMHKLTIEHD QGEKVDVNDDLARELAFYTQALDGTRQAFEKLQSMKVRFLRPTDYYAEMVKTDAHMHKIK GRLLSEKKRIEEAEERRKARESRKKAKEVQAEKKKERAKQKKEQIESVKKWRKQRQQGGF TKGNDDVPDLNFEGEEGFKQSKKKRPGVSPGDRSGGLAKR
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Unknown function duf1138 family
GP002478 |
Unknown function duf1138 family |
| 2 | GP018276 | Unannotated cluster |
| 3 | GP042981 | Unannotated cluster |
| 4 | GP075980 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Eukaryotic rRNA processing
IPR008610
|
Eukaryotic rRNA processing | Family |
Figure 1: IPR domains for Sspon.02G0007720-2B
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Sspon.02G0007720-1A | ultra-paralogy | 0.034 | 0 | - | - |
| Sspon.02G0007720-1P | ultra-paralogy | 0.0024 | 0 | - | - |
| Sspon.02G0007720-3C | ultra-paralogy | 0.0079 | 0 | - | - |
| Sspon.02G0007720-4D | ultra-paralogy | 0.0189 | 0 | - | - |
| maize_pan_p000100 | orthology | 0.0264 | 1 | - | - |