Gene Sspon.02G0011600-1A
Sequence ID | Sspon.02G0011600-1A add to my list |
---|---|
Species | Saccharum spontaneum |
Alias | No gene alias |
Length | 132aa |
Length: 132 amino acids
>Sspon.02G0011600-1A_SACSP MPDKIRLDIDIINILVVRATQLRSEEWESREHSPSLLSDVVVSARLLRRALGSSETLPRL ALPAPAQGNEDLVRSSEPIQLSYTSKALTGAVPKGLEQVKQTLIRPRYPSLVKRHGCRTK DPSVPIVPGILS
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Auxin efflux carrier family
GP000355 |
Auxin efflux carrier family |
2 | GP015273 | Unannotated cluster |
3 | GP040583 | Unannotated cluster |
4 | GP506271 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Mba10_g07270.1 | orthology | 1 | 4 | - | - |
Oeu046999.1 | orthology | 1 | 3 | - | - |
evm_27.model.AmTr_v1.0_scaffold00007.253 | orthology | 1 | 1 | - | - |
evm_27.model.AmTr_v1.0_scaffold00110.131 | orthology | 1 | 1 | - | - |
evm_27.model.AmTr_v1.0_scaffold00210.9 | orthology | 1 | 1 | - | - |
maldo_pan_p047466 | orthology | 1 | 3 | - | - |
musac_pan_p038561 | orthology | 1 | 3 | - | - |