Gene Sspon.03G0007600-4D


Sequence ID Sspon.03G0007600-4D  add to my list
Species Saccharum spontaneum
Alias No gene alias
Length 142aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 142 amino acids

>Sspon.03G0007600-4D_SACSP
MGRTARLGLDKVLDCFSLSLCSNACACIHSVEEEDEDEANERKALVSSQLQELVKLRDFV
DGAAKTLAFHLEPKTVELKVSMHCYGCAKKVQKHISKMDGVTSFEVDLENKKVVVIGDIT
PYEVLESISKVKFAELWVAPQL




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP015837 Unannotated cluster
3 GP040905 Unannotated cluster
4 GP070656 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Sspon.03G0007600-4D



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
ORGLA01G0238900.1 orthology 0.254 4 - -
maize_pan_p020184 orthology 0.18 2 - -
maize_pan_p030082 orthology 0.273 2 - -
maize_pan_p032385 orthology 0.375 2 - -
maize_pan_p044072 orthology 0.178 2 - -
orysa_pan_p027804 orthology 0.247 4 - -
sorbi_pan_p023239 orthology 0.0429 1 - -